(data stored in ACNUC9435 zone)

EMBL: CP000904.PE216

CP000904.PE216       Location/Qualifiers
FT   CDS             complement(323848..324315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5677"
FT                   /product="Transcription factor RsfA"
FT                   /note="TIGRFAM: Transcription factor RsfA; KEGG:
FT                   bca:BCE_3968 DNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5677"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46640"
FT                   /db_xref="InterPro:IPR014243"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUR9"
FT                   /protein_id="ABY46640.1"
FT                   /translation="MVISRQDSWTNDNDSLLATIVLQNIRDGGTQLAAFKAVAKQLART
FT                   PAACGFRWNSYVRKQYEEEIQQAKQNRKSGNNKSPIQQTKETKSLSMTLDVIIIFLQNY
FT                   KEVNEVNNLQQQIEYLTAENKSLLQRLTTYEEEYRMLLNHIDKARNLIVVK"
     MVISRQDSWT NDNDSLLATI VLQNIRDGGT QLAAFKAVAK QLARTPAACG FRWNSYVRKQ        60
     YEEEIQQAKQ NRKSGNNKSP IQQTKETKSL SMTLDVIIIF LQNYKEVNEV NNLQQQIEYL       120
     TAENKSLLQR LTTYEEEYRM LLNHIDKARN LIVVK                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page