(data stored in ACNUC9435 zone)

EMBL: CP000904.PE219

CP000904.PE219       Location/Qualifiers
FT   CDS             327234..327647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5680"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   bcz:pE33L466_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5680"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46643"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS2"
FT                   /protein_id="ABY46643.1"
FT                   /translation="MKNEVILNKISTIERCIKRIQEVYGNNPDNLEDYTKQDSIILNIQ
FT                   RACEASIDLAMHIVAGKKLGLPQSSREAFDLLVDADLLSTELASKLKAMVGFRNIAVHD
FT                   YQSVNLDIVRQIIEKHLKDFKLFTKEVMGILDL"
     MKNEVILNKI STIERCIKRI QEVYGNNPDN LEDYTKQDSI ILNIQRACEA SIDLAMHIVA        60
     GKKLGLPQSS REAFDLLVDA DLLSTELASK LKAMVGFRNI AVHDYQSVNL DIVRQIIEKH       120
     LKDFKLFTKE VMGILDL                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page