(data stored in ACNUC9435 zone)

EMBL: CP000904.PE22

CP000904.PE22        Location/Qualifiers
FT   CDS             43103..44284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5454"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46446"
FT                   /db_xref="GOA:A9VV14"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV14"
FT                   /protein_id="ABY46446.1"
FT                   /translation="MNINKSFKGIAIAGLSVSFILVGCTLNTYGLTQSEYRKVDKYYDA
FT                   DKMVSDLKKLHYSDEHIENQLRNALSRIEYEKGSKEDGSSSKESKSNVSDTEDEKKVTV
FT                   SEKDYPYRLTELHLEFQYHLKKLEKKTDELFTEEGVYISEIDSLISHISLDINRFEKIK
FT                   PPKNYEDYQFLIQEGVEEIRKHLIKVEDAVRQYDDRKYDGEYDKDKAKEIIQNGMIGID
FT                   DGVSKWETVFNGINEKYPDVEQKVKEENQKHAKEGHREDDLNDKVSGSDVDKYKADIVG
FT                   NTNKMDEVIRLIQDIGHSDIKDYESKKSEIQLSLDVAKTHVRDMKYLEAPKGLEVEQEK
FT                   IKQSMDNYWDALQLFSEALEEQNDSKLEQADNKAEQAMKLFKKATESIKSKTN"
     MNINKSFKGI AIAGLSVSFI LVGCTLNTYG LTQSEYRKVD KYYDADKMVS DLKKLHYSDE        60
     HIENQLRNAL SRIEYEKGSK EDGSSSKESK SNVSDTEDEK KVTVSEKDYP YRLTELHLEF       120
     QYHLKKLEKK TDELFTEEGV YISEIDSLIS HISLDINRFE KIKPPKNYED YQFLIQEGVE       180
     EIRKHLIKVE DAVRQYDDRK YDGEYDKDKA KEIIQNGMIG IDDGVSKWET VFNGINEKYP       240
     DVEQKVKEEN QKHAKEGHRE DDLNDKVSGS DVDKYKADIV GNTNKMDEVI RLIQDIGHSD       300
     IKDYESKKSE IQLSLDVAKT HVRDMKYLEA PKGLEVEQEK IKQSMDNYWD ALQLFSEALE       360
     EQNDSKLEQA DNKAEQAMKL FKKATESIKS KTN                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page