(data stored in ACNUC9435 zone)

EMBL: CP000904.PE220

CP000904.PE220       Location/Qualifiers
FT   CDS             327868..328095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5681"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5681"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46644"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS3"
FT                   /protein_id="ABY46644.1"
FT                   /translation="MDALLVRLIFYAGTEWLGFRTLFSSCNLIYQVIKELHIASLSKVF
FT                   GYAKPKFISHLPLGYALHTLEEGEFFRGIS"
     MDALLVRLIF YAGTEWLGFR TLFSSCNLIY QVIKELHIAS LSKVFGYAKP KFISHLPLGY        60
     ALHTLEEGEF FRGIS                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page