(data stored in ACNUC9435 zone)

EMBL: CP000904.PE221

CP000904.PE221       Location/Qualifiers
FT   CDS             complement(328398..328967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5683"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bca:BCE_1177
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5683"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46645"
FT                   /db_xref="GOA:A9VUS4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS4"
FT                   /protein_id="ABY46645.1"
FT                   /translation="MIKLEKENKKMKIIQSATILFSTRGVRNTTVDEIAKKAKVGKGTI
FT                   YYYYTDKTEILCDCYMRHIQLIRSQLFDLYKEEKDVLLRIQKILHYISLEYHQDPFVST
FT                   LFQEYKEYHSPEITACFKKSEEEAIKMISNLLEKGYQQGALHKVPLPLTAFMLVRMIFN
FT                   YEQDYIKDDKSDKEFLQLLKHMLLKN"
     MIKLEKENKK MKIIQSATIL FSTRGVRNTT VDEIAKKAKV GKGTIYYYYT DKTEILCDCY        60
     MRHIQLIRSQ LFDLYKEEKD VLLRIQKILH YISLEYHQDP FVSTLFQEYK EYHSPEITAC       120
     FKKSEEEAIK MISNLLEKGY QQGALHKVPL PLTAFMLVRM IFNYEQDYIK DDKSDKEFLQ       180
     LLKHMLLKN                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page