(data stored in ACNUC9435 zone)

EMBL: CP000904.PE224

CP000904.PE224       Location/Qualifiers
FT   CDS             332192..332371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5686"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bca:BCE_3342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5686"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46648"
FT                   /db_xref="GOA:A9VUS7"
FT                   /db_xref="InterPro:IPR025143"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS7"
FT                   /protein_id="ABY46648.1"
FT                   /translation="MPLENSIYYIGVTIILVIIGALLGGIIRLIQHTSNYKKQDSVEQK
FT                   LDKVIQLLEKQNKD"
     MPLENSIYYI GVTIILVIIG ALLGGIIRLI QHTSNYKKQD SVEQKLDKVI QLLEKQNKD         59
//

If you have problems or comments...

PBIL Back to PBIL home page