(data stored in ACNUC9435 zone)

EMBL: CP000904.PE225

CP000904.PE225       Location/Qualifiers
FT   CDS             332985..333596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5688"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK1840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5688"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46649"
FT                   /db_xref="GOA:A9VUS8"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUS8"
FT                   /protein_id="ABY46649.1"
FT                   /translation="MVDIVNATRQTTSLIESNKSSPSLKFYICIDGNFYSSLDKLFWRN
FT                   FKMEKLKKWFSLSTHKDERIQQIEMKIWAQSGIVVLLLAFIDVIIRGAYLHRPFLEWIA
FT                   SLAIILCYMIFFFIKSILTGVYETDINNKEQLNEKLKEKMSNTFIFCFVAIGATTYKYY
FT                   FPEDFGGWLAAIAKFIILFVFLFGIQYLITVIAWKRSNKI"
     MVDIVNATRQ TTSLIESNKS SPSLKFYICI DGNFYSSLDK LFWRNFKMEK LKKWFSLSTH        60
     KDERIQQIEM KIWAQSGIVV LLLAFIDVII RGAYLHRPFL EWIASLAIIL CYMIFFFIKS       120
     ILTGVYETDI NNKEQLNEKL KEKMSNTFIF CFVAIGATTY KYYFPEDFGG WLAAIAKFII       180
     LFVFLFGIQY LITVIAWKRS NKI                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page