(data stored in ACNUC9435 zone)

EMBL: CP000904.PE227

CP000904.PE227       Location/Qualifiers
FT   CDS             335269..335535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5691"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5691"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46651"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT0"
FT                   /protein_id="ABY46651.1"
FT                   /translation="MFKKLVVGALATGVMLSGATGASAAVDTGNNLNNSNNSIAATCDY
FT                   KTFPYNSKDDMPMVVIKGGIKHYLKGTVINGGQLYGLYEPEYC"
     MFKKLVVGAL ATGVMLSGAT GASAAVDTGN NLNNSNNSIA ATCDYKTFPY NSKDDMPMVV        60
     IKGGIKHYLK GTVINGGQLY GLYEPEYC                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page