(data stored in ACNUC9435 zone)

EMBL: CP000904.PE228

CP000904.PE228       Location/Qualifiers
FT   CDS             336251..337777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5692"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5692"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46652"
FT                   /db_xref="GOA:A9VUT1"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT1"
FT                   /protein_id="ABY46652.1"
FT                   /translation="MDNQLPYQQPKREKALVIGAGIAGLLTARVLSSYFETVIVVEKDE
FT                   LPQKPSERPGTPQDFHPHRVLPRGEIIMNRFFPGYVDNLLNLGAHNVKNDKMIRFSPYG
FT                   ALELVIERKGAASSRALLEWTIRQRVQEISNVHFLSKQVVTGLLTSSDHKRVIGINIQE
FT                   RDELKTKRTVLTDLVVDTCGRQSKLNKWLTSMGYDVPEPERLKVNFGYSTRYYKVPPHI
FT                   KEKLSAISEGDPAKNVGAVGLLYIEDNIAQALLFVAGGTHYPPTNSKEYEKELDSLVTP
FT                   MMRELIKELDPISDPRGFRAHESTRQHFEQMENWPSGLLVLGDAFCNFDPIYGQGMTVA
FT                   AIEAEMLDTCLKEHSTHKPGFERKVLQRMQQAIEPAWWLSSIADLRWEGVEHVGAVPLK
FT                   GVKFTQKYFDLYLKQALKQARDGNSTMLQKYIMMNGLVYSPHEIINSDMLSMLITEDET
FT                   LEGNELLNELGEVDKRSLQERIHELIPSFTLAFENSIPNLFSSISISNAK"
     MDNQLPYQQP KREKALVIGA GIAGLLTARV LSSYFETVIV VEKDELPQKP SERPGTPQDF        60
     HPHRVLPRGE IIMNRFFPGY VDNLLNLGAH NVKNDKMIRF SPYGALELVI ERKGAASSRA       120
     LLEWTIRQRV QEISNVHFLS KQVVTGLLTS SDHKRVIGIN IQERDELKTK RTVLTDLVVD       180
     TCGRQSKLNK WLTSMGYDVP EPERLKVNFG YSTRYYKVPP HIKEKLSAIS EGDPAKNVGA       240
     VGLLYIEDNI AQALLFVAGG THYPPTNSKE YEKELDSLVT PMMRELIKEL DPISDPRGFR       300
     AHESTRQHFE QMENWPSGLL VLGDAFCNFD PIYGQGMTVA AIEAEMLDTC LKEHSTHKPG       360
     FERKVLQRMQ QAIEPAWWLS SIADLRWEGV EHVGAVPLKG VKFTQKYFDL YLKQALKQAR       420
     DGNSTMLQKY IMMNGLVYSP HEIINSDMLS MLITEDETLE GNELLNELGE VDKRSLQERI       480
     HELIPSFTLA FENSIPNLFS SISISNAK                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page