(data stored in ACNUC9435 zone)

EMBL: CP000904.PE229

CP000904.PE229       Location/Qualifiers
FT   CDS             complement(338075..338347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5693"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: bcy:Bcer98_1763 histone family protein DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5693"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46653"
FT                   /db_xref="GOA:A9VUT2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT2"
FT                   /protein_id="ABY46653.1"
FT                   /translation="MNKTELTKVVAEKAELTQKDAAAATQALLDTITNALANGDKVQTL
FT                   GFGTFEVRERSARTGRNPQTGEEMQIAASKAPAFKAGKELKEAVK"
     MNKTELTKVV AEKAELTQKD AAAATQALLD TITNALANGD KVQTLGFGTF EVRERSARTG        60
     RNPQTGEEMQ IAASKAPAFK AGKELKEAVK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page