(data stored in ACNUC9435 zone)

EMBL: CP000904.PE23

CP000904.PE23        Location/Qualifiers
FT   CDS             45389..46816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5456"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bca:BCE_2758 permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5456"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46447"
FT                   /db_xref="GOA:A9VV15"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV15"
FT                   /protein_id="ABY46447.1"
FT                   /translation="MNFIKRAILSMKKRIGTSLILMAVFLIVTNLVLAGFTIQNASKKA
FT                   ADAARKKLGADVTLGLDFDKLGKQARETGEAPNPPQLNTKETDQLAKSKHVKDYNYITH
FT                   NFGIADGFKLVGVSEGEGKGNGNARVATAGGSGSGTEIDMNSSLMIEGVRKTLLQESFK
FT                   NGKNKIVDGKPITEQMQDQNVALMEKRLAEQNNLKVGDKVKVQSGDKKETLEIEIIGIY
FT                   ETNEQPMGQNPPPMINPANKLYMPYSTLKKLEVDEGMSSIQVVYLLNDPQYIDAFKKEA
FT                   KKSDIDFNYFKLDAHDSLYKQMIGPIENIASTSQMIIYMVSIAGAIILGLIIMLSIKAR
FT                   RKEMGILLSIGEKKWKLMAQFVVEVVCIAILAFGLSITTGAKVSQFVGDNLLSSEIATA
FT                   SEETDTSQNSTVMVAGPGGSLQDQKKEPIDKIDVSVTGEDVGKMGGIGLAIAILATLLP
FT                   ALSILRLNPKQILLKDE"
     MNFIKRAILS MKKRIGTSLI LMAVFLIVTN LVLAGFTIQN ASKKAADAAR KKLGADVTLG        60
     LDFDKLGKQA RETGEAPNPP QLNTKETDQL AKSKHVKDYN YITHNFGIAD GFKLVGVSEG       120
     EGKGNGNARV ATAGGSGSGT EIDMNSSLMI EGVRKTLLQE SFKNGKNKIV DGKPITEQMQ       180
     DQNVALMEKR LAEQNNLKVG DKVKVQSGDK KETLEIEIIG IYETNEQPMG QNPPPMINPA       240
     NKLYMPYSTL KKLEVDEGMS SIQVVYLLND PQYIDAFKKE AKKSDIDFNY FKLDAHDSLY       300
     KQMIGPIENI ASTSQMIIYM VSIAGAIILG LIIMLSIKAR RKEMGILLSI GEKKWKLMAQ       360
     FVVEVVCIAI LAFGLSITTG AKVSQFVGDN LLSSEIATAS EETDTSQNST VMVAGPGGSL       420
     QDQKKEPIDK IDVSVTGEDV GKMGGIGLAI AILATLLPAL SILRLNPKQI LLKDE            475
//

If you have problems or comments...

PBIL Back to PBIL home page