(data stored in ACNUC9435 zone)

EMBL: CP000904.PE230

CP000904.PE230       Location/Qualifiers
FT   CDS             complement(338481..338846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5694"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0426 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5694"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46654"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT3"
FT                   /protein_id="ABY46654.1"
FT                   /translation="MVKKACVSIITGILLICSTGCATQTDSITAKTQSIDDGTYTTKEI
FT                   TDAFPVGTPITTYIRKEEKLNVKHLTSITLTDGGVGRVLEATDGFVVVCGNEKGVFDVL
FT                   IFKTLEDVKKYEQSLAR"
     MVKKACVSII TGILLICSTG CATQTDSITA KTQSIDDGTY TTKEITDAFP VGTPITTYIR        60
     KEEKLNVKHL TSITLTDGGV GRVLEATDGF VVVCGNEKGV FDVLIFKTLE DVKKYEQSLA       120
     R                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page