(data stored in ACNUC9435 zone)

EMBL: CP000904.PE231

CP000904.PE231       Location/Qualifiers
FT   CDS             339720..340145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mul:MUL_1266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5695"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46655"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT4"
FT                   /protein_id="ABY46655.1"
FT                   /translation="MLPDYIKIAHEIAKKAHVGQVDKAGMDYIKHPETVASFVNTTEEK
FT                   ATAYLHDVLEDTEITAADLLNAGIPYNVVEAVQVLTKEKYTPYFEYLSKVKENSLARTV
FT                   KLADLKHNSDRSRLARITDKDLKRLEKYRTAIKFLGE"
     MLPDYIKIAH EIAKKAHVGQ VDKAGMDYIK HPETVASFVN TTEEKATAYL HDVLEDTEIT        60
     AADLLNAGIP YNVVEAVQVL TKEKYTPYFE YLSKVKENSL ARTVKLADLK HNSDRSRLAR       120
     ITDKDLKRLE KYRTAIKFLG E                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page