(data stored in ACNUC9435 zone)

EMBL: CP000904.PE232

CP000904.PE232       Location/Qualifiers
FT   CDS             340334..340534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5696"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   btk:BT9727_2306 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5696"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46656"
FT                   /db_xref="GOA:A9VUT5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT5"
FT                   /protein_id="ABY46656.1"
FT                   /translation="MLNNRIVVCRAEKGWTQQDLGERVGASRQTIASMERNKYNPSLIL
FT                   AFKIAQAFGKPLEEVFEFKEE"
     MLNNRIVVCR AEKGWTQQDL GERVGASRQT IASMERNKYN PSLILAFKIA QAFGKPLEEV        60
     FEFKEE                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page