(data stored in ACNUC9435 zone)

EMBL: CP000904.PE233

CP000904.PE233       Location/Qualifiers
FT   CDS             340539..340832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5697"
FT                   /product="group-specific protein"
FT                   /note="KEGG: bcz:BCZK2933 group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5697"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46657"
FT                   /db_xref="GOA:A9VUT6"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT6"
FT                   /protein_id="ABY46657.1"
FT                   /translation="MEFIKYAVIIIIVLSCLSELYMFKFQKSQEARDERGLDIQYKTTN
FT                   FLYNTLYLGIVILFLLNILQYITAEQFVNILLYFFISLGIIKVAYSYWRRSY"
     MEFIKYAVII IIVLSCLSEL YMFKFQKSQE ARDERGLDIQ YKTTNFLYNT LYLGIVILFL        60
     LNILQYITAE QFVNILLYFF ISLGIIKVAY SYWRRSY                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page