(data stored in ACNUC9435 zone)

EMBL: CP000904.PE237

CP000904.PE237       Location/Qualifiers
FT   CDS             344999..345598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5702"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5702"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46661"
FT                   /db_xref="GOA:A9VUU0"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU0"
FT                   /protein_id="ABY46661.1"
FT                   /translation="MKGEENLKMLNSVAPKQIKNEDLPFDISWMTDWIVDWFGSLFNGG
FT                   SDVIKDGGNKVDGVVHASVPAFFDVIFLILSVVILISLLVFGASLWFKHIKWKKRSIYF
FT                   GVGSFILILLIRILPVLMLTTRSFDFQTFMSNMVGLITSIILGTAVLMFLISLALGMLY
FT                   KKFEHPKYGKWSSSLRYSSIFIFVMTLIVPALLRHL"
     MKGEENLKML NSVAPKQIKN EDLPFDISWM TDWIVDWFGS LFNGGSDVIK DGGNKVDGVV        60
     HASVPAFFDV IFLILSVVIL ISLLVFGASL WFKHIKWKKR SIYFGVGSFI LILLIRILPV       120
     LMLTTRSFDF QTFMSNMVGL ITSIILGTAV LMFLISLALG MLYKKFEHPK YGKWSSSLRY       180
     SSIFIFVMTL IVPALLRHL                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page