(data stored in ACNUC9435 zone)

EMBL: CP000904.PE238

CP000904.PE238       Location/Qualifiers
FT   CDS             345759..345986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5703"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5703"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46662"
FT                   /db_xref="GOA:A9VUU1"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU1"
FT                   /protein_id="ABY46662.1"
FT                   /translation="MTTFVVMVSIFLILFVIGPKATKRKEERDRIEKEHKEKMEALEEE
FT                   KIDLDINGTKVRLHKKPKLKKSIYKIKGNR"
     MTTFVVMVSI FLILFVIGPK ATKRKEERDR IEKEHKEKME ALEEEKIDLD INGTKVRLHK        60
     KPKLKKSIYK IKGNR                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page