(data stored in ACNUC9435 zone)

EMBL: CP000904.PE24

CP000904.PE24        Location/Qualifiers
FT   CDS             46828..47514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5457"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bca:BCE_2757 ABC transporter domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5457"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46448"
FT                   /db_xref="GOA:A9VV16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV16"
FT                   /protein_id="ABY46448.1"
FT                   /translation="METILQFKNLDYYYESNGKKVTILDNVNFSFQKGHFYTILGPSGS
FT                   GKTTTLSLGCGLDIPKNGYVLFNGKDIRKIGLDRYRNQNVSVIFQSYNLITYMTALQNV
FT                   LTAMEITGVKVQNKKARALELLEKVGLTEVEAKRNVLQLSGGQQQRVAIARALSCNVDL
FT                   LIADEPTGNLDGETAKEIIELFQELAHQENKCVIVVTHSQEVAKKSDRAVYLSKKKLVV
FT                   NEINNS"
     METILQFKNL DYYYESNGKK VTILDNVNFS FQKGHFYTIL GPSGSGKTTT LSLGCGLDIP        60
     KNGYVLFNGK DIRKIGLDRY RNQNVSVIFQ SYNLITYMTA LQNVLTAMEI TGVKVQNKKA       120
     RALELLEKVG LTEVEAKRNV LQLSGGQQQR VAIARALSCN VDLLIADEPT GNLDGETAKE       180
     IIELFQELAH QENKCVIVVT HSQEVAKKSD RAVYLSKKKL VVNEINNS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page