(data stored in ACNUC9435 zone)

EMBL: CP000904.PE240

CP000904.PE240       Location/Qualifiers
FT   CDS             complement(348324..348644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5708"
FT                   /product="YolD-like protein"
FT                   /note="PFAM: YolD-like protein; KEGG: bat:BAS3054
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5708"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46664"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU3"
FT                   /protein_id="ABY46664.1"
FT                   /translation="MNNANMQQGRGMVKWARFAGIREMIKEKNKVASPILTSEEKELIK
FT                   NMLLCSLLSEEEILITYYEGGYLLTNYMTIIDIDSLNNAIICTDAFYNKLTLQFSDILD
FT                   VK"
     MNNANMQQGR GMVKWARFAG IREMIKEKNK VASPILTSEE KELIKNMLLC SLLSEEEILI        60
     TYYEGGYLLT NYMTIIDIDS LNNAIICTDA FYNKLTLQFS DILDVK                      106
//

If you have problems or comments...

PBIL Back to PBIL home page