(data stored in ACNUC9435 zone)

EMBL: CP000904.PE241

CP000904.PE241       Location/Qualifiers
FT   CDS             complement(349990..351117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5710"
FT                   /product="replication initiator A domain protein"
FT                   /note="PFAM: replication initiator A domain protein; KEGG:
FT                   ssp:SSPP204 replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5710"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46665"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU4"
FT                   /protein_id="ABY46665.1"
FT                   /translation="MLKKRINIKDIPNEEFYKLPKVFIWKKQYRENLSIGAKLLYMLIR
FT                   DRFNLSIYTTQISVDNGNDTPAFVDEKGDIYCILDNQEIEFSLNISNKTVTKFMEELIA
FT                   EELVSTESVDGGANRIYLNEPDPSGASLAHFLGEKEFYKHVKMRKKKKKEPLKTLEECI
FT                   ATAIDKYGVKKVDKKNSITREGKIPVPSDGKSTPLSEEKTPPLGEEKVHPNNIYSSYLD
FT                   LSEIYPNENDTNPNKSSKSKIDEEPIEELKNNIVLQKNNYALLNPILEQVGICPDLKAL
FT                   NVVKKILAEAGITTFHKVDVLNAIGKHAMNVKKYLSQGEVIEYEPAFFANNLVDRIREN
FT                   TLKRQNEVKKLKKIENQQTHETTFHFSSYNWLEVN"
     MLKKRINIKD IPNEEFYKLP KVFIWKKQYR ENLSIGAKLL YMLIRDRFNL SIYTTQISVD        60
     NGNDTPAFVD EKGDIYCILD NQEIEFSLNI SNKTVTKFME ELIAEELVST ESVDGGANRI       120
     YLNEPDPSGA SLAHFLGEKE FYKHVKMRKK KKKEPLKTLE ECIATAIDKY GVKKVDKKNS       180
     ITREGKIPVP SDGKSTPLSE EKTPPLGEEK VHPNNIYSSY LDLSEIYPNE NDTNPNKSSK       240
     SKIDEEPIEE LKNNIVLQKN NYALLNPILE QVGICPDLKA LNVVKKILAE AGITTFHKVD       300
     VLNAIGKHAM NVKKYLSQGE VIEYEPAFFA NNLVDRIREN TLKRQNEVKK LKKIENQQTH       360
     ETTFHFSSYN WLEVN                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page