(data stored in ACNUC9435 zone)

EMBL: CP000904.PE242

CP000904.PE242       Location/Qualifiers
FT   CDS             351803..352237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5711"
FT                   /product="arsenate reductase and related"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   sae:NWMN_0867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5711"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46666"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU5"
FT                   /protein_id="ABY46666.1"
FT                   /translation="MKSLNITIYTINSAEGERVAEKLAKYDLMVTNKHIVRDRFTFTEF
FT                   KALLALTDNGLDDLLTQRGSTIDFLTEQGIDLDDLTLREAYNVILQNPKLLKTTILTDW
FT                   NRIAFGLNGTKMFLPRHLRKQEQRKMYLKPEAQIEYEEAS"
     MKSLNITIYT INSAEGERVA EKLAKYDLMV TNKHIVRDRF TFTEFKALLA LTDNGLDDLL        60
     TQRGSTIDFL TEQGIDLDDL TLREAYNVIL QNPKLLKTTI LTDWNRIAFG LNGTKMFLPR       120
     HLRKQEQRKM YLKPEAQIEY EEAS                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page