(data stored in ACNUC9435 zone)

EMBL: CP000904.PE245

CP000904.PE245       Location/Qualifiers
FT   CDS             353906..354700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5714"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PF10_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5714"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46669"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU8"
FT                   /protein_id="ABY46669.1"
FT                   /translation="MQKTLAKEYIESVAKALLETSPREVIEFKTVLNAHPQGNETHAGI
FT                   NEVISRIFTDPLLTELLSIVGIESEEKTVQEPILASLLASQISTQQLSKQIREQVAKVD
FT                   MDSSVMIPYMKLEPKANLAAFIKEQAAFNKLVEDIKAQFEVNTKEDFAANIKDQVEQQR
FT                   PAKTTEGKIKSILDEVVNEIIEDGAASQTVCLDPSGIKVYEILFSSVFYKKANMLGFKE
FT                   SVEYKHEYTAYILSELATYLVEEEGFKLSFEVVEDKVVAGLA"
     MQKTLAKEYI ESVAKALLET SPREVIEFKT VLNAHPQGNE THAGINEVIS RIFTDPLLTE        60
     LLSIVGIESE EKTVQEPILA SLLASQISTQ QLSKQIREQV AKVDMDSSVM IPYMKLEPKA       120
     NLAAFIKEQA AFNKLVEDIK AQFEVNTKED FAANIKDQVE QQRPAKTTEG KIKSILDEVV       180
     NEIIEDGAAS QTVCLDPSGI KVYEILFSSV FYKKANMLGF KESVEYKHEY TAYILSELAT       240
     YLVEEEGFKL SFEVVEDKVV AGLA                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page