(data stored in ACNUC9435 zone)

EMBL: CP000904.PE246

CP000904.PE246       Location/Qualifiers
FT   CDS             354924..355910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5715"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: bat:BAS3490 prophage LambdaBa01,
FT                   N-acetylmuramoyl-L-alanine amidase, family 2; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SH3 type 3
FT                   domain protein; SMART: SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5715"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46670"
FT                   /db_xref="GOA:A9VUU9"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU9"
FT                   /protein_id="ABY46670.1"
FT                   /translation="MAIPVIQNLVAASKYPIKAPYSMNAEYITVHNTYNDAPAKNEINY
FT                   MVGNNNEVSFHFAVDDIEVIQGIPVNRNAWHCGDGSGNGNRKSIGVEICYSLSGGPRYE
FT                   KAESLAIKFVAQLLRERGWGIDRVRTHKSWTEIGVRNGNSRAVKNCPHRILDEGRWNSF
FT                   LAAVQAELTGTGATIAPPVTQPPSSDGIGVVEILVPELNVREFASFDSRVVKTVKKGEM
FT                   YQTWGLSNGLYNVGGNQWVSAGPAYVKFTPAGSSNGNPENLAGKRDPIGKITTTANLNV
FT                   RTQSSTDGDIIRTIPNGETWNIYDISGGWARVHDGWVSLAYANLTRY"
     MAIPVIQNLV AASKYPIKAP YSMNAEYITV HNTYNDAPAK NEINYMVGNN NEVSFHFAVD        60
     DIEVIQGIPV NRNAWHCGDG SGNGNRKSIG VEICYSLSGG PRYEKAESLA IKFVAQLLRE       120
     RGWGIDRVRT HKSWTEIGVR NGNSRAVKNC PHRILDEGRW NSFLAAVQAE LTGTGATIAP       180
     PVTQPPSSDG IGVVEILVPE LNVREFASFD SRVVKTVKKG EMYQTWGLSN GLYNVGGNQW       240
     VSAGPAYVKF TPAGSSNGNP ENLAGKRDPI GKITTTANLN VRTQSSTDGD IIRTIPNGET       300
     WNIYDISGGW ARVHDGWVSL AYANLTRY                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page