(data stored in ACNUC9435 zone)

EMBL: CP000904.PE247

CP000904.PE247       Location/Qualifiers
FT   CDS             357113..357484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5716"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: amt:Amet_0033 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5716"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46671"
FT                   /db_xref="GOA:A9VUV0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV0"
FT                   /protein_id="ABY46671.1"
FT                   /translation="MHQIITITGRLTRDPESNTYGEKTVCRFAVAVDDGYGDKKTTDFF
FT                   NVSVWGKMGEKVQRYQKKGSVVQVIGKMKSSKKDKTTYWELRANNIVFFTFDNNSNQQQ
FT                   NNFEMFTDDINISDDDLPF"
     MHQIITITGR LTRDPESNTY GEKTVCRFAV AVDDGYGDKK TTDFFNVSVW GKMGEKVQRY        60
     QKKGSVVQVI GKMKSSKKDK TTYWELRANN IVFFTFDNNS NQQQNNFEMF TDDINISDDD       120
     LPF                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page