(data stored in ACNUC9435 zone)

EMBL: CP000904.PE248

CP000904.PE248       Location/Qualifiers
FT   CDS             357515..357847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5717"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46672"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV1"
FT                   /protein_id="ABY46672.1"
FT                   /translation="MSDQRRLRSELKQGLHQFTMTLYNSYRQTLSHEKSVEQLSNCLIE
FT                   EYEYLTKQVMKQEKTFNLGSLVEKVEKRAKDEKDPVKQFELYEDVEILLRAQELVTKYE
FT                   TGKDNK"
     MSDQRRLRSE LKQGLHQFTM TLYNSYRQTL SHEKSVEQLS NCLIEEYEYL TKQVMKQEKT        60
     FNLGSLVEKV EKRAKDEKDP VKQFELYEDV EILLRAQELV TKYETGKDNK                  110
//

If you have problems or comments...

PBIL Back to PBIL home page