(data stored in ACNUC9435 zone)

EMBL: CP000904.PE249

CP000904.PE249       Location/Qualifiers
FT   CDS             359188..359406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5719"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46673"
FT                   /db_xref="GOA:A9VUV2"
FT                   /db_xref="InterPro:IPR006479"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV2"
FT                   /protein_id="ABY46673.1"
FT                   /translation="MFKDILMDNKGALIRIIVFVLAWLNQYLTSKGYQPLPVLGEAEVA
FT                   AVVTFIASVLTLINDNKVTSKTKELKE"
     MFKDILMDNK GALIRIIVFV LAWLNQYLTS KGYQPLPVLG EAEVAAVVTF IASVLTLIND        60
     NKVTSKTKEL KE                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page