(data stored in ACNUC9435 zone)

EMBL: CP000904.PE25

CP000904.PE25        Location/Qualifiers
FT   CDS             complement(47790..47954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5458"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46449"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV17"
FT                   /protein_id="ABY46449.1"
FT                   /translation="MSEIIEVTEDNTYAGVEKAEVFRIGTAYSTTNRSLIKTIKYTYLC
FT                   SVAQCLKLS"
     MSEIIEVTED NTYAGVEKAE VFRIGTAYST TNRSLIKTIK YTYLCSVAQC LKLS              54
//

If you have problems or comments...

PBIL Back to PBIL home page