(data stored in ACNUC9435 zone)

EMBL: CP000904.PE250

CP000904.PE250       Location/Qualifiers
FT   CDS             360366..361085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5720"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46674"
FT                   /db_xref="GOA:A9VUV3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV3"
FT                   /protein_id="ABY46674.1"
FT                   /translation="MNSANLGWFVLSQTILGIGSYAIMCAIFCLRFHRNITMISLLSFL
FT                   TSIINYSIYFNKQEGIGYLVPIIGMLITFLYLAAIEKLSIMWALVVTVAGGVIIPLIIQ
FT                   IMIIFASLGFFSPSELKEHIWRNYAMDITSGFSYALLAFVLYSQEWTFKFDFEKIRFKY
FT                   EKYIVIGISLVAAIVLPASMFMTHVKGTDLNLIFLTISSTLVFILLLIFSIRKERTEKQ
FT                   FDKTIKEVKTNAQKNDV"
     MNSANLGWFV LSQTILGIGS YAIMCAIFCL RFHRNITMIS LLSFLTSIIN YSIYFNKQEG        60
     IGYLVPIIGM LITFLYLAAI EKLSIMWALV VTVAGGVIIP LIIQIMIIFA SLGFFSPSEL       120
     KEHIWRNYAM DITSGFSYAL LAFVLYSQEW TFKFDFEKIR FKYEKYIVIG ISLVAAIVLP       180
     ASMFMTHVKG TDLNLIFLTI SSTLVFILLL IFSIRKERTE KQFDKTIKEV KTNAQKNDV        239
//

If you have problems or comments...

PBIL Back to PBIL home page