(data stored in ACNUC9435 zone)

EMBL: CP000904.PE251

CP000904.PE251       Location/Qualifiers
FT   CDS             361481..362068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5721"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46675"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV4"
FT                   /protein_id="ABY46675.1"
FT                   /translation="MSNKDKSNIFEKTFGELLENNKEENDAVIDQSRDKLEEVLLRAEG
FT                   KKILSHEDRGESTEGYISPSIKDEKLEEFVGEMPLPPINREQESRAVSIGLQEIREMKE
FT                   YMLYIHRYMINEFNRIYASFPILFAKDFEDKFGTAHKELATIMEDIERFIIGDIYNVEA
FT                   VKNDFKLVQTLEGKRLSILYDFLEYQNNKKLQ"
     MSNKDKSNIF EKTFGELLEN NKEENDAVID QSRDKLEEVL LRAEGKKILS HEDRGESTEG        60
     YISPSIKDEK LEEFVGEMPL PPINREQESR AVSIGLQEIR EMKEYMLYIH RYMINEFNRI       120
     YASFPILFAK DFEDKFGTAH KELATIMEDI ERFIIGDIYN VEAVKNDFKL VQTLEGKRLS       180
     ILYDFLEYQN NKKLQ                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page