(data stored in ACNUC9435 zone)

EMBL: CP000904.PE252

CP000904.PE252       Location/Qualifiers
FT   CDS             362131..362409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5722"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46676"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV5"
FT                   /protein_id="ABY46676.1"
FT                   /translation="MIFKVKQLLQILHRDEVVYMENKQIVSYNAQSRGHKTKGNTYKER
FT                   YVENTCPECQNPRAYKDEWKTRIKYTCLKRACRHQWFEKKEFPEVKE"
     MIFKVKQLLQ ILHRDEVVYM ENKQIVSYNA QSRGHKTKGN TYKERYVENT CPECQNPRAY        60
     KDEWKTRIKY TCLKRACRHQ WFEKKEFPEV KE                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page