(data stored in ACNUC9435 zone)

EMBL: CP000904.PE253

CP000904.PE253       Location/Qualifiers
FT   CDS             362534..363271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5723"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; KEGG: lmo:lmo2522
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5723"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46677"
FT                   /db_xref="GOA:A9VUV6"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV6"
FT                   /protein_id="ABY46677.1"
FT                   /translation="MKTKIKKGKIIQNCLKVTAATVVASGVGFQFYEIQELNKEVKSLE
FT                   KNHKQTVLELKTANEKNKVLEEQKKQIAANTEQLSIELEEIKNENEAINQGKHQSLEEN
FT                   QKLQAENADLAKQLREAKESARPVMPEKPSSDKSDPPTAKDTSVSRTIMGIGTAYTLNE
FT                   PGVTGITASGKTIQPGMIAMDRSVPMGTRVRITCDSYPYINGIYTVEDRGGAIKGNIVD
FT                   IYMTDADRMNDFGRRDIKIECLN"
     MKTKIKKGKI IQNCLKVTAA TVVASGVGFQ FYEIQELNKE VKSLEKNHKQ TVLELKTANE        60
     KNKVLEEQKK QIAANTEQLS IELEEIKNEN EAINQGKHQS LEENQKLQAE NADLAKQLRE       120
     AKESARPVMP EKPSSDKSDP PTAKDTSVSR TIMGIGTAYT LNEPGVTGIT ASGKTIQPGM       180
     IAMDRSVPMG TRVRITCDSY PYINGIYTVE DRGGAIKGNI VDIYMTDADR MNDFGRRDIK       240
     IECLN                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page