(data stored in ACNUC9435 zone)

EMBL: CP000904.PE254

CP000904.PE254       Location/Qualifiers
FT   CDS             364877..365584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5725"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sae:NWMN_1328 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5725"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46678"
FT                   /db_xref="GOA:A9VUV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV7"
FT                   /protein_id="ABY46678.1"
FT                   /translation="MYRLLLLEDEVEIGSTLEMILRSENYHIDWFTTGDEAVNAAVSND
FT                   YDLMILDVMLKKTVGELNTRISNGLEVARLVNQKKKIPYLLLTSRSEPLDIMQGLDMGA
FT                   EDYITKPYDLTVLLARIRTVLRRSCSNDISNGGITRCGNIEINLLTHKVIVEGKHVHLT
FT                   KQLFELLHYFIIHKGQIISKEELYKNIWGYDPSELQETNTLEVNIRRLRNSLDVDIIKT
FT                   VRGKGYVLEVSSC"
     MYRLLLLEDE VEIGSTLEMI LRSENYHIDW FTTGDEAVNA AVSNDYDLMI LDVMLKKTVG        60
     ELNTRISNGL EVARLVNQKK KIPYLLLTSR SEPLDIMQGL DMGAEDYITK PYDLTVLLAR       120
     IRTVLRRSCS NDISNGGITR CGNIEINLLT HKVIVEGKHV HLTKQLFELL HYFIIHKGQI       180
     ISKEELYKNI WGYDPSELQE TNTLEVNIRR LRNSLDVDII KTVRGKGYVL EVSSC            235
//

If you have problems or comments...

PBIL Back to PBIL home page