(data stored in ACNUC9435 zone)

EMBL: CP000904.PE255

CP000904.PE255       Location/Qualifiers
FT   CDS             365559..367049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5726"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ppe:PEPE_0715
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5726"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46679"
FT                   /db_xref="GOA:A9VUV8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV8"
FT                   /protein_id="ABY46679.1"
FT                   /translation="MFLKSLVARRIKNNKLHMKIMAVAVIAVTLITIPIQLLFFVSVVL
FT                   KNGEEAFSHIKYRAIQIENEAWRIGGGDKIHQEFFDGILLKGEEIKVSSAAKNTEYTFY
FT                   IKQNEEAISSVDKYFSAFLIETLVKRHQKEINKLGNISIRNDETNGLYYMTYKHTFKHG
FT                   DNNETIIVKRNVTPIVIKLIEKYQKEFFIYLLYFIIAISIFIYFGLGLVFRFFGKALDK
FT                   SFVELKEKDYKARIDIKDSYGKEISNVQHQINGILEQMQNNIEVNIESMQDVSHEVNNK
FT                   LTSIKQSIDVLRFYGTNNKLIVEQKLKSIDDNIEQITKVMSTFLDLAKLDRGIYMDATK
FT                   SRDVKEMIENYLQYIKKVFPDFDFIGKYDVRSPSIHFSKEHFVLALNPIIENAVRYSLQ
FT                   SNEIVIHIRKGKYLNYVYIDIINWGIQIEKEEIPQLFNRYYRGKNIENSMKGFGMGLTI
FT                   SKKVMHLYKGKIHVKSYEDGKNIFTLIIPLHQESRGDT"
     MFLKSLVARR IKNNKLHMKI MAVAVIAVTL ITIPIQLLFF VSVVLKNGEE AFSHIKYRAI        60
     QIENEAWRIG GGDKIHQEFF DGILLKGEEI KVSSAAKNTE YTFYIKQNEE AISSVDKYFS       120
     AFLIETLVKR HQKEINKLGN ISIRNDETNG LYYMTYKHTF KHGDNNETII VKRNVTPIVI       180
     KLIEKYQKEF FIYLLYFIIA ISIFIYFGLG LVFRFFGKAL DKSFVELKEK DYKARIDIKD       240
     SYGKEISNVQ HQINGILEQM QNNIEVNIES MQDVSHEVNN KLTSIKQSID VLRFYGTNNK       300
     LIVEQKLKSI DDNIEQITKV MSTFLDLAKL DRGIYMDATK SRDVKEMIEN YLQYIKKVFP       360
     DFDFIGKYDV RSPSIHFSKE HFVLALNPII ENAVRYSLQS NEIVIHIRKG KYLNYVYIDI       420
     INWGIQIEKE EIPQLFNRYY RGKNIENSMK GFGMGLTISK KVMHLYKGKI HVKSYEDGKN       480
     IFTLIIPLHQ ESRGDT                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page