(data stored in ACNUC9435 zone)

EMBL: CP000904.PE256

CP000904.PE256       Location/Qualifiers
FT   CDS             367049..368578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5727"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ser:SERP0988
FT                   sensor histidine kinase ArlS"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5727"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46680"
FT                   /db_xref="GOA:A9VUV9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV9"
FT                   /protein_id="ABY46680.1"
FT                   /translation="MGNKIRKFLNNFVKRDKLRVQVVLLTLILVLVSAIPVNLFSIYNE
FT                   LQLTTQREFESMFSRVEKIQDKIVLSGISASQELDSEFFKQISYPGESMKIRMGEQGAQ
FT                   DYHYAAEYEQNDKFGMFEAQILTLFVPTFFDSIKAHMKSLDATADKDSYSFYIDEKNKA
FT                   YGEILHSFKHKSHYDTIIIKKDITPNLKMQMVNSMENFLYMFIWFFFFSVVSVLVCLKF
FT                   IFKPLQSAMDSSFENVVDNNYQTRIEDPLYGEEISKIVHRFNAVLDRMHELVQNNLNSM
FT                   QDVSHEIKTYLTAIKQSVDVIKLYGKSDEKLVAEKLNAIEDNIIRATAIISTTLELARL
FT                   KQIPNIDSANYYDVKYLVNFLLRFKQETYPSFIFETDYDSEDVEIFIDRNHFFLMMSPI
FT                   LDNAVKYSMNSNIVKIDTISKRIDNMVYISIANTGVVIDQKEIPFLFDRYYRGKNLGNS
FT                   KQGSGLGLTIAKEVMDLYKGRITVHGTAAGVTSFILSFPKAIRREDSGNLS"
     MGNKIRKFLN NFVKRDKLRV QVVLLTLILV LVSAIPVNLF SIYNELQLTT QREFESMFSR        60
     VEKIQDKIVL SGISASQELD SEFFKQISYP GESMKIRMGE QGAQDYHYAA EYEQNDKFGM       120
     FEAQILTLFV PTFFDSIKAH MKSLDATADK DSYSFYIDEK NKAYGEILHS FKHKSHYDTI       180
     IIKKDITPNL KMQMVNSMEN FLYMFIWFFF FSVVSVLVCL KFIFKPLQSA MDSSFENVVD       240
     NNYQTRIEDP LYGEEISKIV HRFNAVLDRM HELVQNNLNS MQDVSHEIKT YLTAIKQSVD       300
     VIKLYGKSDE KLVAEKLNAI EDNIIRATAI ISTTLELARL KQIPNIDSAN YYDVKYLVNF       360
     LLRFKQETYP SFIFETDYDS EDVEIFIDRN HFFLMMSPIL DNAVKYSMNS NIVKIDTISK       420
     RIDNMVYISI ANTGVVIDQK EIPFLFDRYY RGKNLGNSKQ GSGLGLTIAK EVMDLYKGRI       480
     TVHGTAAGVT SFILSFPKAI RREDSGNLS                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page