(data stored in ACNUC9435 zone)

EMBL: CP000904.PE257

CP000904.PE257       Location/Qualifiers
FT   CDS             complement(368768..369037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5728"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46681"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW0"
FT                   /protein_id="ABY46681.1"
FT                   /translation="MKIYRGNIGVDLSLEEFSRLIVDEEKIDDLLNLIYTLEMDEIMNY
FT                   NRDDIQALEESLFQEIAEYQRKQNSNDTTAKMEYILAHLKKYER"
     MKIYRGNIGV DLSLEEFSRL IVDEEKIDDL LNLIYTLEMD EIMNYNRDDI QALEESLFQE        60
     IAEYQRKQNS NDTTAKMEYI LAHLKKYER                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page