(data stored in ACNUC9435 zone)

EMBL: CP000904.PE258

CP000904.PE258       Location/Qualifiers
FT   CDS             369686..370018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5729"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46682"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW1"
FT                   /protein_id="ABY46682.1"
FT                   /translation="MNKQEAIEIIKNSFYHLMFEENVKVGSINVLLYFPSIGIAVLEPN
FT                   KDRRHLLIEDNIEDMDELYIKKELKAKPIYLDLENDEFNIGFVINDILLEARFAPAENF
FT                   LESRGT"
     MNKQEAIEII KNSFYHLMFE ENVKVGSINV LLYFPSIGIA VLEPNKDRRH LLIEDNIEDM        60
     DELYIKKELK AKPIYLDLEN DEFNIGFVIN DILLEARFAP AENFLESRGT                  110
//

If you have problems or comments...

PBIL Back to PBIL home page