(data stored in ACNUC9435 zone)

EMBL: CP000904.PE259

CP000904.PE259       Location/Qualifiers
FT   CDS             370644..371078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5730"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46683"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW2"
FT                   /protein_id="ABY46683.1"
FT                   /translation="MREMRYGLSGYLAPDGIFYECDYGKHSELANELIEKYKIKNKTNY
FT                   NEIATRGEFLKFGTYPWSSKEGCSGCHVFKSLFHPLSNKQSIWINENLDKLTDKQRSEL
FT                   NRLLDQEELIRNKLAMESKKDVEKIQISYRVGTRLSAVGV"
     MREMRYGLSG YLAPDGIFYE CDYGKHSELA NELIEKYKIK NKTNYNEIAT RGEFLKFGTY        60
     PWSSKEGCSG CHVFKSLFHP LSNKQSIWIN ENLDKLTDKQ RSELNRLLDQ EELIRNKLAM       120
     ESKKDVEKIQ ISYRVGTRLS AVGV                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page