(data stored in ACNUC9435 zone)

EMBL: CP000904.PE26

CP000904.PE26        Location/Qualifiers
FT   CDS             complement(48714..49163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5459"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: cvi:CV_0866
FT                   probable transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5459"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46450"
FT                   /db_xref="GOA:A9VV18"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV18"
FT                   /protein_id="ABY46450.1"
FT                   /translation="MTNSINKINAIDELSQAIYSLTAADGRLRGRATRTLGAVSMVHAR
FT                   TLKVLAEEGELSVKELADRAETTAAGITQLINGLQQAGYVERVRSNNDRRVVKVRLTPI
FT                   GLNCHLEREEKLKHILNANLSDFDADQIEKSSEIIRCLVHVLDQL"
     MTNSINKINA IDELSQAIYS LTAADGRLRG RATRTLGAVS MVHARTLKVL AEEGELSVKE        60
     LADRAETTAA GITQLINGLQ QAGYVERVRS NNDRRVVKVR LTPIGLNCHL EREEKLKHIL       120
     NANLSDFDAD QIEKSSEIIR CLVHVLDQL                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page