(data stored in ACNUC9435 zone)

EMBL: CP000904.PE260

CP000904.PE260       Location/Qualifiers
FT   CDS             complement(371939..372376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5732"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46684"
FT                   /db_xref="GOA:A9VUW3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW3"
FT                   /protein_id="ABY46684.1"
FT                   /translation="MTPDEIGIIEKIFVSITEGDKPFMVLFAIIMLFAIFMSIKVMGYV
FT                   RSVSDSHKDQMTSMNENMKEQREDHYKMIAEDRLRSDNRERELFVNLEKNTQQLEGIAT
FT                   TLKEVQFNFTSLENKVTQNFDYLEKEIESVKIKVSKKENYE"
     MTPDEIGIIE KIFVSITEGD KPFMVLFAII MLFAIFMSIK VMGYVRSVSD SHKDQMTSMN        60
     ENMKEQREDH YKMIAEDRLR SDNRERELFV NLEKNTQQLE GIATTLKEVQ FNFTSLENKV       120
     TQNFDYLEKE IESVKIKVSK KENYE                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page