(data stored in ACNUC9435 zone)

EMBL: CP000904.PE261

CP000904.PE261       Location/Qualifiers
FT   CDS             complement(372909..373163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5733"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46685"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW4"
FT                   /protein_id="ABY46685.1"
FT                   /translation="MIEYIENDNSDKPQVNIYIGEDEWAKYSFQNKVRLLYRLKNSDNV
FT                   LAKELVKSISSLIEEEQKMSEIDYEATVKQCENMIEWFE"
     MIEYIENDNS DKPQVNIYIG EDEWAKYSFQ NKVRLLYRLK NSDNVLAKEL VKSISSLIEE        60
     EQKMSEIDYE ATVKQCENMI EWFE                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page