(data stored in ACNUC9435 zone)

EMBL: CP000904.PE262

CP000904.PE262       Location/Qualifiers
FT   CDS             complement(373167..373343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5734"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46686"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW5"
FT                   /protein_id="ABY46686.1"
FT                   /translation="MKSQRKKYEFSEKWVECLNCSQEYVIEYVIDERDTKGCPVCGSYA
FT                   HEDPASEYSNWSA"
     MKSQRKKYEF SEKWVECLNC SQEYVIEYVI DERDTKGCPV CGSYAHEDPA SEYSNWSA          58
//

If you have problems or comments...

PBIL Back to PBIL home page