(data stored in ACNUC9435 zone)

EMBL: CP000904.PE263

CP000904.PE263       Location/Qualifiers
FT   CDS             373499..373957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5735"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46687"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW6"
FT                   /protein_id="ABY46687.1"
FT                   /translation="MNYMKKIDEAIELFKNLISATTNEAKSAVLATNQDNEIADKLLVL
FT                   LKNKTLYLPALTLLPSITKNDSNKRLRNYVSFVNAIDKLEGKKLNAYVFDYVLRHIDEE
FT                   ELKMYKAILTNADLVPVVKEPVDETVLEEKIQEEVTQVEKIQEDVESE"
     MNYMKKIDEA IELFKNLISA TTNEAKSAVL ATNQDNEIAD KLLVLLKNKT LYLPALTLLP        60
     SITKNDSNKR LRNYVSFVNA IDKLEGKKLN AYVFDYVLRH IDEEELKMYK AILTNADLVP       120
     VVKEPVDETV LEEKIQEEVT QVEKIQEDVE SE                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page