(data stored in ACNUC9435 zone)

EMBL: CP000904.PE264

CP000904.PE264       Location/Qualifiers
FT   CDS             374646..374891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5737"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46688"
FT                   /db_xref="GOA:A9VUW7"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW7"
FT                   /protein_id="ABY46688.1"
FT                   /translation="MKKFIETLKKEIKEILDCCKKPLWKLRYFFYGWALGGAIGTTYFY
FT                   KIGEIDEYGVLLRITAAIILFILPLAYGEKNEVGSG"
     MKKFIETLKK EIKEILDCCK KPLWKLRYFF YGWALGGAIG TTYFYKIGEI DEYGVLLRIT        60
     AAIILFILPL AYGEKNEVGS G                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page