(data stored in ACNUC9435 zone)

EMBL: CP000904.PE265

CP000904.PE265       Location/Qualifiers
FT   CDS             375493..376014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5738"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5738"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46689"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW8"
FT                   /protein_id="ABY46689.1"
FT                   /translation="MIVGDIIVVSGKSLISKIIQKVAGSKWTHVALYIGGGYIIEIDWN
FT                   TKSSIVREKYSISNLECMVLRNKNALTKEQQDIIISTAVSYQRKGFRYDWLRLISLYLK
FT                   SKFPNNKLIDKLDRRNKFICTELVDEILKEAGIDLFPNQGGDIFPHDYLACEQLIALNK
FT                   VKWSSYKKAN"
     MIVGDIIVVS GKSLISKIIQ KVAGSKWTHV ALYIGGGYII EIDWNTKSSI VREKYSISNL        60
     ECMVLRNKNA LTKEQQDIII STAVSYQRKG FRYDWLRLIS LYLKSKFPNN KLIDKLDRRN       120
     KFICTELVDE ILKEAGIDLF PNQGGDIFPH DYLACEQLIA LNKVKWSSYK KAN              173
//

If you have problems or comments...

PBIL Back to PBIL home page