(data stored in ACNUC9435 zone)

EMBL: CP000904.PE267

CP000904.PE267       Location/Qualifiers
FT   CDS             378529..378786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5741"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46691"
FT                   /db_xref="InterPro:IPR025915"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX0"
FT                   /protein_id="ABY46691.1"
FT                   /translation="MEGLRYERFEQNLLDHWVKLKESAKVGLKTTVVCLQMNNGFEVVG
FT                   QSACMNPDEYDYELGVYYATKDALKRIADIVAYIEHEGTF"
     MEGLRYERFE QNLLDHWVKL KESAKVGLKT TVVCLQMNNG FEVVGQSACM NPDEYDYELG        60
     VYYATKDALK RIADIVAYIE HEGTF                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page