(data stored in ACNUC9435 zone)

EMBL: CP000904.PE268

CP000904.PE268       Location/Qualifiers
FT   CDS             379097..379576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5742"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46692"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX1"
FT                   /protein_id="ABY46692.1"
FT                   /translation="MATKEREIETYDTSSFLQKNRSKVAMGAVGGFAYGAKHLIQTQPV
FT                   QGLVKSEIFDEEKGIFKKAKKGSRMQFSGKKLGTAIGKGHYAVTATVLDVGRRIEGYDD
FT                   TEEIKGEQEFQLRKKMKKQREKNRNLYGNINQGEVVFNLFESRTGHHKMGNAKFN"
     MATKEREIET YDTSSFLQKN RSKVAMGAVG GFAYGAKHLI QTQPVQGLVK SEIFDEEKGI        60
     FKKAKKGSRM QFSGKKLGTA IGKGHYAVTA TVLDVGRRIE GYDDTEEIKG EQEFQLRKKM       120
     KKQREKNRNL YGNINQGEVV FNLFESRTGH HKMGNAKFN                              159
//

If you have problems or comments...

PBIL Back to PBIL home page