(data stored in ACNUC9435 zone)

EMBL: CP000904.PE269

CP000904.PE269       Location/Qualifiers
FT   CDS             380203..380601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5743"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46693"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX2"
FT                   /protein_id="ABY46693.1"
FT                   /translation="MAILNSIKNFAKIGVLNTKKAVNGVKNAPNNIIKSTFIDTKNKKK
FT                   TLANLYTGKRINPKHFAVVGGGYLAFNQAKMSFEYQMEPLKRATMNDYQYIGSPEIMMY
FT                   DGVGQERVSKNLNVDGSIVFDLHNNRRG"
     MAILNSIKNF AKIGVLNTKK AVNGVKNAPN NIIKSTFIDT KNKKKTLANL YTGKRINPKH        60
     FAVVGGGYLA FNQAKMSFEY QMEPLKRATM NDYQYIGSPE IMMYDGVGQE RVSKNLNVDG       120
     SIVFDLHNNR RG                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page