(data stored in ACNUC9435 zone)

EMBL: CP000904.PE27

CP000904.PE27        Location/Qualifiers
FT   CDS             49411..50685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5460"
FT                   /product="protein of unknown function DUF1100 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF1100 hydrolase
FT                   family protein; KEGG: cvi:CV_0865 probable dipeptidyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5460"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46451"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV19"
FT                   /protein_id="ABY46451.1"
FT                   /translation="MTQRSQSQGWALDIALALGGFDALHPEAKATMEQLGHDHTDFDKV
FT                   FSQVKSGAMIPKAWATVAAQAQERAKHYEQKGFTVTARDLYQRAAVMWGRAQYSYFNDD
FT                   PRKLAFRERCNECVAAISSLGGGTVQRIVLEFEGKQIYALLHLPSGEIRNAPAVILGPG
FT                   MDMIKEDYIQIAQRYYTSRGIVALSIEGPGQGESVSGGLKVDLANYERAVSCYIDFLSK
FT                   RPEVDPNRIGFFGISMSGYWGMRAAASDNRINAIATFEGVYGEFDTIFNRAQPSFKANF
FT                   MYMSGYTDEVAFENELSSQMNLWKLAPKITCPVFMGIGEFDELTRLEEALSLYELVEAP
FT                   KELRVYENEFHPLGGVAAEIFRFGAEWVELALEGNFKNDYDERYYMHRDGGVTEGTAFP
FT                   TYWLGAQPAEIKARKKCNTLNACKS"
     MTQRSQSQGW ALDIALALGG FDALHPEAKA TMEQLGHDHT DFDKVFSQVK SGAMIPKAWA        60
     TVAAQAQERA KHYEQKGFTV TARDLYQRAA VMWGRAQYSY FNDDPRKLAF RERCNECVAA       120
     ISSLGGGTVQ RIVLEFEGKQ IYALLHLPSG EIRNAPAVIL GPGMDMIKED YIQIAQRYYT       180
     SRGIVALSIE GPGQGESVSG GLKVDLANYE RAVSCYIDFL SKRPEVDPNR IGFFGISMSG       240
     YWGMRAAASD NRINAIATFE GVYGEFDTIF NRAQPSFKAN FMYMSGYTDE VAFENELSSQ       300
     MNLWKLAPKI TCPVFMGIGE FDELTRLEEA LSLYELVEAP KELRVYENEF HPLGGVAAEI       360
     FRFGAEWVEL ALEGNFKNDY DERYYMHRDG GVTEGTAFPT YWLGAQPAEI KARKKCNTLN       420
     ACKS                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page