(data stored in ACNUC9435 zone)

EMBL: CP000904.PE270

CP000904.PE270       Location/Qualifiers
FT   CDS             380607..381002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5744"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46694"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX3"
FT                   /protein_id="ABY46694.1"
FT                   /translation="MKVKSMIKTLTSPQAIFGYNVARGLHGGDSLGTSVAKASIKGVLS
FT                   ASNPVLFGVVTWGSLAQKGYWGLLEFNHQREQWWKAQYATSNVVGGNFLDTRGAQTMRQ
FT                   AAVQAIQGSKMNARSALGGEAKILSPY"
     MKVKSMIKTL TSPQAIFGYN VARGLHGGDS LGTSVAKASI KGVLSASNPV LFGVVTWGSL        60
     AQKGYWGLLE FNHQREQWWK AQYATSNVVG GNFLDTRGAQ TMRQAAVQAI QGSKMNARSA       120
     LGGEAKILSP Y                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page