(data stored in ACNUC9435 zone)

EMBL: CP000904.PE271

CP000904.PE271       Location/Qualifiers
FT   CDS             381046..382410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5745"
FT                   /product="replicative DNA helicase"
FT                   /note="SMART: Hedgehog/intein hint domain protein; KEGG:
FT                   msm:MSMEG_6892 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5745"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46695"
FT                   /db_xref="GOA:A9VUX4"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX4"
FT                   /protein_id="ABY46695.1"
FT                   /translation="MSEIINLEREMLQIIHDPVQRGEHHLGGSPSWYQEQIIRQSHHRE
FT                   GLRYGERVGKCIEENQRIINSNTGEYKSIGELYQSQLDGIATPLLTLNEFYQLKNSKAF
FT                   SIEDNGVQDTFAVVTKHGARVTLTRNHPILTVDGWKEVDALCIGERIATPKFLTVYGTK
FT                   QVEKNKLRILAYMLAAGRLNKNSISFQIRYEGVGESLQKSCEAIGITTYHEHHKKATVY
FT                   LMDFRSFEFYREIEEKKIPSFIYELDRDHLAFFLGSLYSAGGWFCAGRISEIGYATKCR
FT                   KFALDLKHLLLRFGIQTNLLQKEMNGSVYYHLMVYHCSSILLFLEHLATPERNYEAVQQ
FT                   RALKMKPSEPTLPKEVWKYIEKERIVKGMTKAEVVGKGNRRYRTEKGISLSNAREYAEN
FT                   LQFAMLHYLIDSHVIWEEVVEIIPYGKRQTYDVFVPETHNLVVEDILVFSPCTNV"
     MSEIINLERE MLQIIHDPVQ RGEHHLGGSP SWYQEQIIRQ SHHREGLRYG ERVGKCIEEN        60
     QRIINSNTGE YKSIGELYQS QLDGIATPLL TLNEFYQLKN SKAFSIEDNG VQDTFAVVTK       120
     HGARVTLTRN HPILTVDGWK EVDALCIGER IATPKFLTVY GTKQVEKNKL RILAYMLAAG       180
     RLNKNSISFQ IRYEGVGESL QKSCEAIGIT TYHEHHKKAT VYLMDFRSFE FYREIEEKKI       240
     PSFIYELDRD HLAFFLGSLY SAGGWFCAGR ISEIGYATKC RKFALDLKHL LLRFGIQTNL       300
     LQKEMNGSVY YHLMVYHCSS ILLFLEHLAT PERNYEAVQQ RALKMKPSEP TLPKEVWKYI       360
     EKERIVKGMT KAEVVGKGNR RYRTEKGISL SNAREYAENL QFAMLHYLID SHVIWEEVVE       420
     IIPYGKRQTY DVFVPETHNL VVEDILVFSP CTNV                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page